Pp3c10_16310V3.1.p (PRGDB2110454)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110454	Pp3c10_16310V3.1.p	L	putative	LRR	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c17_20920V3.2.p	Physcomitrella patens	64.6	48	1e-11
Pp3c17_20920V3.1.p	Physcomitrella patens	64.6	48	1e-11
Pp3c17_18970V3.2.p	Physcomitrella patens	71.7	46	3e-11
Pp3c17_18970V3.1.p	Physcomitrella patens	71.7	46	3e-11
Pp3c13_15270V3.2.p	Physcomitrella patens	68.1	47	5e-11
Pp3c17_20961V3.1.p	Physcomitrella patens	60.4	48	5e-11
Pp3c13_15270V3.1.p	Physcomitrella patens	68.1	47	6e-11
Pp3c21_15570V3.1.p	Physcomitrella patens	66	47	1e-10
Pp3c16_23150V3.1.p	Physcomitrella patens	66	47	1e-10
Pp3c16_23150V3.2.p	Physcomitrella patens	66	47	1e-10

Showing 1 to 10 of 111 entries

Protein sequence

FCSSLTSFPNELGYLTSFNMLHISNCSKSTSIPNKLSNLTNLTKLNVS