Pp3c19_10570V3.1.p (PRGDB2110108)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110108	Pp3c19_10570V3.1.p	N	putative	NBS, TM	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c14_6750V3.2.p	Physcomitrella patens	74.5	47	1e-15
Pp3c13_15270V3.2.p	Physcomitrella patens	68.1	47	1e-14
Pp3c14_1440V3.1.p	Physcomitrella patens	63.8	47	2e-14
Pp3c13_15270V3.1.p	Physcomitrella patens	66	47	3e-14
Pp3c21_7380V3.1.p	Physcomitrella patens	68.1	47	8e-14
Pp3c14_1440V3.2.p	Physcomitrella patens	63.8	47	1e-13
Pp3c13_21290V3.2.p	Physcomitrella patens	66	47	1e-13
Pp3c21_3920V3.1.p	Physcomitrella patens	68.1	47	2e-13
Pp3c21_11770V3.1.p	Physcomitrella patens	59.6	47	2e-13
Pp3c14_1111V3.1.p	Physcomitrella patens	66	47	2e-13

Showing 1 to 10 of 41 entries

Protein sequence

VEFILAILINKSLIKLDKDGIIRIHDQLYDMDRNIVKKKVEYKYLQI