Pp3c1_34490V3.1.p (PRGDB2110114)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110114	Pp3c1_34490V3.1.p	N	putative	NBS	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c16_23160V3.2.p	Physcomitrella patens	72.4	105	1e-42
Pp3c16_23160V3.1.p	Physcomitrella patens	72.4	105	1e-42
Pp3c13_2610V3.1.p	Physcomitrella patens	70.5	105	3e-40
Pp3c13_2610V3.2.p	Physcomitrella patens	70.5	105	1e-39
Pp3c13_19900V3.1.p	Physcomitrella patens	65.7	102	2e-38
Pp3c13_3150V3.1.p	Physcomitrella patens	67.6	105	4e-38
Pp3c13_15270V3.2.p	Physcomitrella patens	68.3	101	1e-37
Pp3c13_2910V3.1.p	Physcomitrella patens	67.6	105	2e-37
Pp3c21_18280V3.2.p	Physcomitrella patens	63.8	105	3e-37
Pp3c13_15270V3.1.p	Physcomitrella patens	68.3	101	3e-37

Showing 1 to 10 of 134 entries

Protein sequence

KFLHELAKVDKKILKACNSLLLSLKVTSVCLRWKKRLRYYERVLQRLKKGRKLDGDEKNSDHKIWDILRV
SFDNLKAKEKNIFLDICYFFCNDVYSTGILKEGAL