Pp3c4_13340V3.1.p (PRGDB2110117)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110117	Pp3c4_13340V3.1.p	N	putative	NBS	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c20_20770V3.1.p	Physcomitrella patens	46.9	81	4e-14
Pp3c2_13120V3.1.p	Physcomitrella patens	78	41	1e-13
Pp3c6_5450V3.2.p	Physcomitrella patens	63.8	47	3e-13
Pp3c6_5610V3.1.p	Physcomitrella patens	47.4	78	4e-13
Pp3c6_5620V3.1.p	Physcomitrella patens	47.4	78	6e-13
Pp3c6_11870V3.2.p	Physcomitrella patens	46.1	78	8e-13
Pp3c6_11870V3.1.p	Physcomitrella patens	46.1	78	9e-13
Pp3c20_20770V3.2.p	Physcomitrella patens	75.6	41	3e-12
Pp3c20_20760V3.1.p	Physcomitrella patens	77.5	40	3e-12
Pp3c2_12950V3.1.p	Physcomitrella patens	75.6	41	4e-12

Showing 1 to 10 of 64 entries

Protein sequence

MDVKEHLSNIKELCKGRINTLCFIDMDGIEKTILAKATFDNMQHMYDRRRNLDGDEDSNYKLWSILKISF
DTLKIEEKNIFLDILCLS