Pp3c6_6000V3.1.p (PRGDB2110124)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110124	Pp3c6_6000V3.1.p	N	putative	NBS	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c20_15960V3.2.p	Physcomitrella patens	74.3	70	9e-29
Pp3c2_12950V3.1.p	Physcomitrella patens	75.7	70	4e-28
Pp3c20_15960V3.1.p	Physcomitrella patens	74.3	70	2e-27
Pp3c2_12940V3.1.p	Physcomitrella patens	75.7	70	3e-27
Pp3c6_8150V3.1.p	Physcomitrella patens	74.3	70	2e-26
Pp3c11_21080V3.2.p	Physcomitrella patens	68.6	70	4e-26
Pp3c9_16400V3.2.p	Physcomitrella patens	66.2	71	5e-26
Pp3c20_20770V3.2.p	Physcomitrella patens	71.4	70	6e-26
Pp3c6_5920V3.1.p	Physcomitrella patens	71.4	70	6e-26
Pp3c6_5930V3.1.p	Physcomitrella patens	71.4	70	1e-25

Showing 1 to 10 of 91 entries

Protein sequence

KVIKEYFTKIHKFNVEELDKDATLKLFITYSYRDGGELPKELIEIDKEIVRSCNELLLNLKVLGSFYQGQ
ELYEKVI