Pp3c6_5910V3.1.p (PRGDB2110508)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110508	Pp3c6_5910V3.1.p	RLP	putative	LRR, TM	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c6_5450V3.2.p	Physcomitrella patens	70.6	160	3e-49
Pp3c6_11870V3.1.p	Physcomitrella patens	68.9	161	2e-48
Pp3c6_11870V3.2.p	Physcomitrella patens	68.9	161	2e-48
Pp3c20_15920V3.1.p	Physcomitrella patens	63.9	169	1e-47
Pp3c8_2380V3.2.p	Physcomitrella patens	60	165	2e-46
Pp3c8_2380V3.1.p	Physcomitrella patens	60	165	2e-46
Pp3c21_15570V3.1.p	Physcomitrella patens	63.8	160	7e-46
Pp3c17_21720V3.1.p	Physcomitrella patens	59.1	164	1e-45
Pp3c15_16820V3.1.p	Physcomitrella patens	63.2	163	1e-45
Pp3c17_21720V3.2.p	Physcomitrella patens	59.1	164	2e-45

Showing 1 to 10 of 499 entries

Protein sequence

NNKILKIMSKELTNLTFLKTLDMSGWSNLTKLPNELVNLSSLTTLDMSGFSSLTSLPNELANLSSLKILN
LSRYSSLTSLRNELKNLSSLTILHLSGCSCLISLPNGFVNLSSLTTLDLSDCSNLTYLPNEVTNLSSLII
LDLSGCLSLISLPNEILDLSSLASFDLSGCLN