Pp3c7_22100V3.1.p (PRGDB2110659)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110659	Pp3c7_22100V3.1.p	L	putative	LRR	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c7_22100V3.2.p	Physcomitrella patens	99.9	168	5e-120
Pp3c11_5590V3.4.p	Physcomitrella patens	93.5	168	3e-113
Pp3c11_5590V3.1.p	Physcomitrella patens	93.5	168	3e-113
Pp3c11_5590V3.3.p	Physcomitrella patens	93.5	168	8e-113
Pp3c11_5590V3.2.p	Physcomitrella patens	93.5	168	8e-113
EFJ12407	Selaginella moellendorffii	73.7	167	2e-90
EFJ20034	Selaginella moellendorffii	73.7	167	2e-90
EFJ34839	Selaginella moellendorffii	72.5	167	8e-85
EFJ06871	Selaginella moellendorffii	72.5	167	2e-84
Potri.003G166200.1	Populus trichocarpa	74.2	163	1e-82

Showing 1 to 10 of 499 entries

Protein sequence

WDPTLVNPCTWFHVTCDGQNRVIRVDLGNARLSGSLVSELGALQNLQYLELYKNSLTGHIPSELGKLKSL
VSLDLYHNNFTGSIPRSLGKLSNLAFLRLNNNKLTGRIPRELTSITTLKAVDFSNNDLCGTIPVTGSFSH
LQAKSFDNNPRLNGPELEGFVPYEMSCH