875982 (PRGDB211146)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB211146	875982	N	putative	NBS	Arabidopsis lyrata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.43359s0001.1.p	Arabidopsis halleri	95.1	81	1e-48
Cagra.5017s0001.2.p	Conradina grandiflora	82.7	81	5e-42
Cagra.5017s0001.1.p	Conradina grandiflora	82.7	81	2e-41
Bostr.10040s0286.1.p	Babiana stricta	85.2	81	1e-40
Bostr.10040s0286.2.p	Babiana stricta	85.2	81	1e-40
Bostr.10040s0269.1.p	Babiana stricta	82.7	81	2e-40
Bostr.10040s0251.1.p	Babiana stricta	80.2	81	6e-39
Bostr.13404s0084.1.p	Babiana stricta	80.2	81	1e-37
Cagra.4331s0003.1.p	Conradina grandiflora	77.8	81	2e-37
Bostr.10040s0248.1.p	Babiana stricta	80.2	81	2e-37

Showing 1 to 10 of 499 entries

Protein sequence

MGSIGKTTLARQVFNHEIVKNHFDGVAWVCISQQFTRKYVWHTILQKLSAQHDEYRDSNMTEDELQDKLF
RQLEISNSLIVTSYS