Pp3c21_7390V3.1.p (PRGDB2111516)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2111516	Pp3c21_7390V3.1.p	KIN	putative	Kinase	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c21_7380V3.1.p	Physcomitrella patens	98.9	89	7e-56
Pp3c21_6250V3.1.p	Physcomitrella patens	78	100	7e-47
Pp3c18_4530V3.1.p	Physcomitrella patens	75	100	3e-45
Pp3c21_15570V3.1.p	Physcomitrella patens	74	100	6e-45
Pp3c17_20870V3.1.p	Physcomitrella patens	77	100	6e-45
Pp3c17_20880V3.1.p	Physcomitrella patens	77	100	6e-45
Pp3c18_4530V3.2.p	Physcomitrella patens	75	100	3e-44
Pp3c21_15570V3.2.p	Physcomitrella patens	74	100	1e-43
Pp3c8_2150V3.2.p	Physcomitrella patens	74	100	2e-43
Pp3c21_8750V3.2.p	Physcomitrella patens	62	100	2e-40

Showing 1 to 10 of 499 entries

Protein sequence

MHQIAKGMCYLHDIYIVHRDLKLENILINIVESKITNKIFQHVVKIIDFEMSKIEVGRNPKAIENNYIYR
SLRYMAPEALRNKFQSMEMCHFEVDVYSF