AT4G16930.1 (PRGDB211261)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB211261	AT4G16930.1	TN	putative	NBS, TIR	Arabidopsis thaliana

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Thhalv10026484m	Eutrema salsugineum	67.1	143	7e-64
Bostr.3148s0224.1.p	Babiana stricta	63.3	158	1e-57
Bostr.29223s0096.1.p	Babiana stricta	64.5	155	5e-57
Bostr.29223s0074.1.p	Babiana stricta	65.2	155	6e-57
Bostr.29223s0080.1.p	Babiana stricta	63.2	155	6e-56
Bostr.5342s0004.1.p	Babiana stricta	61.4	158	2e-55
AT4G16950.2	Arabidopsis thaliana	66	150	4e-55
Bostr.29223s0072.1.p	Babiana stricta	64.5	155	4e-55
RPP5	Arabidopsis thaliana	66	150	5e-55
AT4G16950.1	Arabidopsis thaliana	66	150	5e-55

Showing 1 to 10 of 499 entries

Protein sequence

MVTPIFYEVDHSDVRKQTGEFGKVFEETCKNKTDDEKQRCRKALADVANMAGEDSRNWCNEANMIETISN
DVPNKLITPSSDLGDFVGVEAHLERLSSLLCLESEEARMVGIGKSTLGRALFSQLSSQFPLRAFVTYKPT
EKNRFYQKFYVKRT