Potri.011G014100.1 (PRGDB2113416)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113416	Potri.011G014100.1	T	putative	TM, TIR	Populus trichocarpa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Potri.011G014100.2	Populus trichocarpa	99.9	166	1e-122
Potri.T069500.1	Populus trichocarpa	99.4	166	3e-116
Potri.011G013200.1	Populus trichocarpa	97	166	3e-111
Potri.T067500.1	Populus trichocarpa	96.4	166	2e-110
Potri.011G013900.1	Populus trichocarpa	95.2	166	1e-109
Potri.011G013700.1	Populus trichocarpa	95.2	166	4e-109
Potri.011G013700.2	Populus trichocarpa	95.2	166	4e-109
Potri.011G013700.3	Populus trichocarpa	95.2	166	4e-109
Potri.T068600.1	Populus trichocarpa	95.8	166	6e-109
Potri.011G013400.1	Populus trichocarpa	96.4	166	7e-109

Showing 1 to 10 of 499 entries

Protein sequence

MAAGKYQESYSSRFSNCKYQVFLSFRGEDTRKNFTDHLYKALVDAGFHTFRDDDEIRRGKNIELELQKAI
QQSKIAIIVFSKNYAWSRWCLDELVMIMERKRNADCIVFPVFYHVDPSEVRNQTGSFAAAFVEHEKHYKE
EMERVNGWRIALKEVANLAGMDLGDG