Potri.017G105100.1 (PRGDB2113438)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113438	Potri.017G105100.1	T	putative	TIR	Populus trichocarpa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Potri.014G064800.3	Populus trichocarpa	87.1	147	1e-89
Potri.014G063600.1	Populus trichocarpa	90.8	131	2e-86
Potri.017G103100.2	Populus trichocarpa	92.2	129	4e-86
Potri.T074100.1	Populus trichocarpa	87.8	139	1e-84
Potri.T074100.2	Populus trichocarpa	87.8	139	1e-84
Potri.T073600.2	Populus trichocarpa	88.5	131	1e-84
Potri.017G103300.3	Populus trichocarpa	87	139	8e-82
Potri.T073900.1	Populus trichocarpa	89.2	139	4e-81
Potri.T074300.1	Populus trichocarpa	92	138	4e-81
Potri.T073700.1	Populus trichocarpa	90.7	139	5e-81

Showing 1 to 10 of 499 entries

Protein sequence

MTSSSSSPPPLYMHDVFLSFRGKETRNNFTSHLYSNLKQRGIDVYMDDRELERGKAIEPALWKAIEESRI
SVVIFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSDVAERKRKYEKAFVEHEQNFKENLEK