Prupe.7G017000.1.p (PRGDB2117973)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2117973	Prupe.7G017000.1.p	T	putative	TM, TIR	Prunus persica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.7G037000.2.p	Prunus persica	88.3	111	1e-53
Prupe.7G037000.1.p	Prunus persica	88.3	111	1e-53
Prupe.7G037600.1.p	Prunus persica	85.6	111	1e-52
MDP0000304068	Malus domestica	70.3	101	4e-44
MDP0000302603	Malus domestica	70.3	101	4e-44
Prupe.3G169500.1.p	Prunus persica	71.9	96	2e-43
Prupe.1G523900.1.p	Prunus persica	59.3	140	2e-43
Prupe.1G524000.1.p	Prunus persica	64	111	2e-42
MDP0000177824	Malus domestica	62.2	111	5e-40
mrna35168.1-v1.0-hybrid	Fragaria vesca	55.1	136	1e-39

Showing 1 to 10 of 499 entries

Protein sequence

MYTQRISASSSSTTPQWKYDVFLSFRGDDTRKDFTDHLYETLRAQGIITRRDEPKISKGKAISRELIAAI
EGSRFALIILSQNYASSTWCLDELLHILKFMQAREAMLPIYISFYILLMEYVLHLLKIVLEKFASHRSSL
MF