Prupe.8G032000.1.p (PRGDB2117976)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2117976	Prupe.8G032000.1.p	T	putative	TIR	Prunus persica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.8G034900.1.p	Prunus persica	90	170	2e-96
Prupe.8G053300.7.p	Prunus persica	85.9	170	1e-95
Prupe.8G053300.4.p	Prunus persica	85.9	170	1e-95
Prupe.8G053300.2.p	Prunus persica	85.9	170	1e-94
Prupe.8G053300.3.p	Prunus persica	85.9	170	1e-94
Prupe.8G053300.5.p	Prunus persica	85.9	170	1e-94
Prupe.8G053300.6.p	Prunus persica	85.9	170	1e-94
Prupe.8G031800.2.p	Prunus persica	90.6	170	4e-94
Prupe.8G034700.1.p	Prunus persica	84.2	158	7e-93
Prupe.6G160100.1.p	Prunus persica	83.5	170	2e-92

Showing 1 to 10 of 499 entries

Protein sequence

MALSTQRDSAFLTSPDQSAPQPNHDVFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDPKLERGTAISSG
LFNAIDESRLAIIVLSPNYTSSSWCLDELTEILQCMKSKSTVLPVFYHVDPSDVRKQTGSFACAFTEHEK
RFREDMEKVKSWRAALTEVANLSGFDSKNE