Prupe.1G161400.1.p (PRGDB2117981)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2117981	Prupe.1G161400.1.p	T	putative	TIR	Prunus persica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.1G161700.1.p	Prunus persica	83.8	167	1e-85
Prupe.1G162200.1.p	Prunus persica	83.2	167	2e-85
Prupe.1G162500.2.p	Prunus persica	80.7	166	6e-83
Prupe.1G162500.1.p	Prunus persica	80.7	166	1e-82
Prupe.1G161800.1.p	Prunus persica	82.2	163	2e-82
Prupe.5G019000.3.p	Prunus persica	79.5	166	1e-80
Prupe.5G019000.2.p	Prunus persica	79.5	166	1e-80
Prupe.5G019000.4.p	Prunus persica	79.5	166	2e-80
Prupe.5G019000.1.p	Prunus persica	79.5	166	2e-80
MDP0000287354	Malus domestica	74	154	8e-74

Showing 1 to 10 of 499 entries

Protein sequence

MLASLANQRASSSSASFTNSWKHDVFLSFRGLDTRSNFTGHLYSALCQQGINTFMDDDELRRGEEISSTL
LTAIEDSKISVVVFSKNYASSKWCLEELVKILDCKKSEQLVIPVFYKVNPSDVRNHRGSFGDALANVECK
YKDNMEKVNRWREALSQAANLSGFTLLDE