Prupe.2G057000.1.p (PRGDB2117985)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2117985	Prupe.2G057000.1.p	N	putative	NBS, TM	Prunus persica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.2G088500.1.p	Prunus persica	60.7	178	4e-58
Prupe.2G055200.3.p	Prunus persica	51.4	177	5e-46
Prupe.2G055200.1.p	Prunus persica	51.4	177	1e-45
Prupe.2G055200.2.p	Prunus persica	51.4	177	1e-45
MDP0000130702	Malus domestica	48.9	176	4e-45
MDP0000171229	Malus domestica	47.5	177	3e-44
MDP0000125814	Malus domestica	48	177	1e-43
MDP0000207170	Malus domestica	50.3	177	1e-43
MDP0000177416	Malus domestica	48	177	3e-43
Prupe.2G057800.2.p	Prunus persica	48.6	177	1e-42

Showing 1 to 10 of 499 entries

Protein sequence

MDFLGLNNYHNAHELFSMMSFKRKEPPNDYLVLARRAIACAQYLPLALSMLGSHLRNQYYEARPFEEIQK
ILRTSYGGLTNRAQQVFLDIAFFFKGKDMDYVIQVLKCHKLESPENCIQELDFEQMGKDIVHEKSPNEPG
RRSKLCCYEDVHEVLTENTVST