29757.m000714 (PRGDB2121052)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2121052	29757.m000714	NL	putative	NBS, LRR, TM	Ricinus communis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
29757.m000712	Ricinus communis	71.2	177	2e-74
Potri.T077200.3	Populus trichocarpa	61.7	175	2e-69
Potri.T077200.4	Populus trichocarpa	61.7	175	8e-69
Manes.18G115300.2.p	Manihot esculenta	67.2	174	1e-68
Manes.18G115300.1.p	Manihot esculenta	67.2	174	1e-68
Manes.18G115500.3.p	Manihot esculenta	66.7	174	4e-68
Manes.18G115500.2.p	Manihot esculenta	66.7	174	7e-68
Manes.18G115500.1.p	Manihot esculenta	66.7	174	1e-67
Potri.T077200.2	Populus trichocarpa	60.2	181	1e-67
Potri.T077200.1	Populus trichocarpa	60.2	181	1e-66

Showing 1 to 10 of 499 entries

Protein sequence

MYSIKAIADIKRILDGCGFSAGIGISVLADKCLVAIQENKLEMHNLLQEMAHEIVRQESAKELGRRSRFW
SPNDACQVLRKNLGTERVEGIFFDTYKMGAVDLSSRAFVRMYNLRLLKIYNSRVGNNCKDGYPLSYMPSN
FQAENLVQLNLAYSSIEQLWTRVQAHLFRSYELQEAQESSLSF