EFJ26573 (PRGDB2126302)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2126302	EFJ26573	N	putative	NBS	Selaginella moellendorffii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
evm.model.supercontig_18.146	Carica papaya	50.8	197	5e-62
Cre16.g650151.t1.1	Chlamydomonas reinhardtii	51.3	199	8e-62
Vocar.0032s0138.1.p	Volvox carteri	52.5	198	3e-61
Pp3c11_13620V3.2.p	Physcomitrella patens	52.3	195	3e-59
DCAR_006880	Daucus carota	51.3	189	8e-59
Pp3c11_13620V3.1.p	Physcomitrella patens	52.3	195	1e-58
16445	Micromonas pusilla	48	198	3e-51
GSMUA_Achr10P21590_001	Musa acuminata	45.7	199	4e-50
97315	Micromonas	47.5	198	6e-50
20304	Coccomyxa subellipsoidea	45	198	7e-50

Showing 1 to 10 of 499 entries

Protein sequence

ISNEIMERDSNVRWDDIAGLDHAKKSVTEMVIWPLLRPDIFRGCRSPGKGLLLFGPPGTGKTTIGKAIAG
ELKATFFSSSLTSKWIGEGEKLVRALFGVASCRTPAVIFIDEVDSLLSQEIRGEHESSRRIKAQFLIEME
GIGSGNEQLLLIGKPGTDRWTVEFDKNVLGATNRPQELDEAARHRFSKRLYIPL