EFJ20754 (PRGDB2127606)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2127606	EFJ20754	N	putative	NBS	Selaginella moellendorffii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Mapoly3272s0001.1.p	Marchantia polymorpha	42.2	180	5e-30
Mapoly2364s0001.1.p	Marchantia polymorpha	40	180	2e-28
Mapoly0105s0002.1.p	Marchantia polymorpha	38.8	183	3e-28
Mapoly3858s0001.1.p	Marchantia polymorpha	39.3	183	3e-28
EFJ22032	Selaginella moellendorffii	40	175	1e-27
EFJ18316	Selaginella moellendorffii	40	175	4e-27
Pp3c3_38130V3.2.p	Physcomitrella patens	35.9	184	4e-22
Pp3c3_38130V3.1.p	Physcomitrella patens	35.9	184	4e-22
Pp3c10_50V3.3.p	Physcomitrella patens	35.9	184	8e-22
Pp3c10_50V3.1.p	Physcomitrella patens	35.9	184	9e-22

Showing 1 to 10 of 499 entries

Protein sequence

GGSGKTLLTQTVTNSLSVNNHFGGKVYWLTVARNPNIARLQSRLRKHIGRGEQLFSSEEAGRKTLINCLK
NSKVLLILDDVWDGNVLQWFDVVDAPGSKILLTSRNNSVFDKVPSTVIEVKLLSDEHSWNLFCGCAFPGQ
DRQQLEHDMEPILAERVKQVVSECKGLPLAL