Bostr.2618s0008.1.p (PRGDB212912)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB212912	Bostr.2618s0008.1.p	T	putative	TIR	Babiana stricta

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.1947s0007.1.p	Arabidopsis halleri	37.6	157	5e-14
Araha.1947s0002.1.p	Arabidopsis halleri	38.9	144	1e-12
Araha.9424s0006.1.p	Arabidopsis halleri	37.5	128	7e-9
884134	Arabidopsis lyrata	30.5	151	2e-8
Cagra.1562s0043.1.p	Conradina grandiflora	40	75	6e-8
Bostr.27895s0043.1.p	Babiana stricta	41.6	77	9e-8
AT1G51270.4	Arabidopsis thaliana	39.2	79	1e-7
AT1G51270.2	Arabidopsis thaliana	38.5	78	2e-7
AT1G51270.3	Arabidopsis thaliana	39.2	79	2e-7
862192	Arabidopsis lyrata	46	76	3e-7

Showing 1 to 10 of 14 entries

Protein sequence

MKIREGMEEGKIMVIPIFYKLDISAVKGLEGEGGFGLNLLNPAMREFDLEQLKILKEALGSVSCMMGFQL
HMNSDESKRTLTQMSMAEKICKSHDQLNEEQNDDFVNTSKSERVNGEDDGRHWIAKSDENPKDVLESDQG
EA