Bostr.30057s0021.1.p (PRGDB212915)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB212915	Bostr.30057s0021.1.p	T	putative	TM, TIR	Babiana stricta

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.30057s0089.1.p	Babiana stricta	49.2	246	1e-54
AT1G57670.1	Arabidopsis thaliana	47.3	220	2e-53
314953	Arabidopsis lyrata	52.1	217	1e-48
Bostr.30057s0016.1.p	Babiana stricta	42.2	268	3e-42
Bostr.30057s0020.1.p	Babiana stricta	40.3	233	1e-39
Bostr.30057s0023.1.p	Babiana stricta	49.4	162	6e-38
Bostr.30057s0017.1.p	Babiana stricta	48.4	192	1e-35
Thhalv10024109m	Eutrema salsugineum	48.6	144	1e-34
Bostr.30057s0056.1.p	Babiana stricta	39.3	252	2e-32
Bostr.22684s0001.1.p	Babiana stricta	45.2	146	2e-30

Showing 1 to 10 of 154 entries

Protein sequence

MATLSRPAHKVFVNFRGKDILYDTTIKFFIDTHEQKGRDLKHLFERIEQATVALIILSTRLEDVRKEEGV
ISRRFCSCAEESSREDTDKWQVALKAVCNKFGSRSEAKFIKKIVKEVGKVLTSIPSKDVRVKKVKTYNVT
LSLPPPWFGSSVGLICVVVGLLVESLHKCASLAMVVLARQLCFVVVAMSSRWTDRSV