Bostr.26833s0012.1.p (PRGDB212986)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB212986	Bostr.26833s0012.1.p	T	putative	TM, TIR	Babiana stricta

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.7365s0047.1.p	Babiana stricta	92.4	105	2e-61
Bostr.7365s0047.2.p	Babiana stricta	92.4	105	2e-61
Bostr.24399s0076.1.p	Babiana stricta	89	118	2e-61
Bostr.9600s0045.1.p	Babiana stricta	89.4	104	4e-60
Bostr.24399s0033.1.p	Babiana stricta	95.5	89	2e-57
Bostr.7365s0041.1.p	Babiana stricta	89.5	105	3e-57
Thhalv10019540m	Eutrema salsugineum	71	124	1e-52
Cagra.1761s0003.1.p	Conradina grandiflora	76.2	105	7e-51
860415	Arabidopsis lyrata	74.3	105	9e-50
AT5G38344.1	Arabidopsis thaliana	72.4	105	2e-48

Showing 1 to 10 of 499 entries

Protein sequence

MDIKAERKLKKQTGDFGKVFAETCIDCFKSTMPQLIAELLLLLEISFLIRSVILHLLSIVIMASSSSIHS
SSLSRNWEYDVFVSFHGKDVRRFVLSHILKEFKNKGINPFIDNEIKRGKFIGPELKKAIYGSRIAIALLS
KRYASSSWCLDELVEIMKCKEELGQTVITIFYEVDPTDV