Bostr.3751s0027.1.p (PRGDB212999)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB212999	Bostr.3751s0027.1.p	N	putative	NBS	Babiana stricta

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.3751s0038.1.p	Babiana stricta	95.5	134	3e-86
Bostr.3751s0024.1.p	Babiana stricta	91.6	131	2e-81
Bostr.3751s0036.1.p	Babiana stricta	93.1	130	3e-81
Bostr.3751s0029.1.p	Babiana stricta	90	130	2e-79
Bostr.3751s0033.2.p	Babiana stricta	87.7	130	2e-79
Bostr.3751s0033.1.p	Babiana stricta	87.7	130	6e-78
Bostr.3751s0041.1.p	Babiana stricta	89.8	127	5e-77
493978	Arabidopsis lyrata	86.2	130	2e-74
Cagra.4715s0009.1.p	Conradina grandiflora	86.2	130	3e-74
AT5G40090.1	Arabidopsis thaliana	83.8	130	1e-71

Showing 1 to 10 of 499 entries

Protein sequence

MDSVRVRVRVWTAYSKWILEYANWFAPGSRVILISQNKNLLVDAGVKHAHEVRSLRYDEALQLFSHFAFK
QPDPPSDFEQLAVRAVHLADFLPLAHRLLGSFLTGKDRKEWVAELLKLKANQGGNIMEVWKLMEPSGDKG
QEEWEMQQT