Bostr.10273s0063.1.p (PRGDB213022)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB213022	Bostr.10273s0063.1.p	TN	putative	NBS, TM, TIR	Babiana stricta

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.10273s0061.1.p	Babiana stricta	81.1	217	1e-119
AT1G72920.1	Arabidopsis thaliana	78.7	216	4e-119
Bostr.10273s0062.1.p	Babiana stricta	80.7	218	3e-117
877392	Arabidopsis lyrata	78.2	216	3e-115
AT1G72940.1	Arabidopsis thaliana	76.4	216	2e-113
Bostr.10273s0060.1.p	Babiana stricta	76.3	215	1e-109
877393	Arabidopsis lyrata	73.2	216	6e-107
AT1G72950.1	Arabidopsis thaliana	72.1	215	4e-103
Cagra.1013s0016.1.p	Conradina grandiflora	75.5	200	7e-99
Araha.27996s0008.1.p	Arabidopsis halleri	69.6	217	1e-94

Showing 1 to 10 of 499 entries

Protein sequence

MSSAATATKYDVFLSFRGTDTRRNFISFLYNELVRRNIRTFKDDKDLEIGRRISPELKRAIEESTFAVVV
VSVNYAASPWCLEELVKIMDLEKKGSITVIPIFYGVEPCHVRRQIGEVAEQFKKHEDREEDHEKVLSWKR
ALTDLASISGRCSLNWVDESNMVDDIADKISKKLRIDTHMKALNRLLDLNSNKSVRVLGIWGSGYI