Solyc06g065130.1.1 (PRGDB2133600)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2133600	Solyc06g065130.1.1	N	putative	NBS	Solanum lycopersicum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
PGSC0003DMT400080429	Solanum tuberosum	85.3	34	1e-13
Medtr7g078780.1	Medicago truncatula	47.3	55	1e-7
Medtr7g078780.2	Medicago truncatula	47.3	55	1e-7
Prupe.8G046700.1.p	Prunus persica	62.9	35	2e-7
VIT_18s0001g06240.t01	Vitis vinifera	56.8	37	3e-7
Araha.8600s0003.1.p	Arabidopsis halleri	60.6	33	4e-7
Bostr.30275s0429.1.p	Babiana stricta	60.6	33	4e-7
Phvul.006G010000.1	Phaseolus vulgaris	60.6	33	4e-7
Ciclev10024297m	Citrus clementina	64.7	34	5e-7
Glyma.08G192900.1.p	Glycine max	50	44	5e-7

Showing 1 to 10 of 15 entries

Protein sequence

MKKLLRLSHEEKNIFLDMACFFRGRKRDDVITILNSFGFQIRDWNRYPHPKITLIYF