Solyc10g055110.1.1 (PRGDB2133607)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2133607	Solyc10g055110.1.1	N	putative	NBS	Solanum lycopersicum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Solyc10g054970.1.1	Solanum lycopersicum	79.7	74	2e-35
PGSC0003DMT400056487	Solanum tuberosum	79.7	74	7e-32
Solyc10g055050.1.1	Solanum lycopersicum	74.3	74	1e-30
PGSC0003DMT400007829	Solanum tuberosum	70.3	74	3e-27
PGSC0003DMT400007823	Solanum tuberosum	70.3	74	3e-27
maker_scaffold2907_snap_gene_0_55_mRNA_1	Solanum commersonii	66.7	75	1e-24
PGSC0003DMT400007331	Solanum tuberosum	65.3	75	2e-24
PGSC0003DMT400007328	Solanum tuberosum	65.3	75	2e-24
PGSC0003DMT400007326	Solanum tuberosum	65.3	75	2e-24
Solyc04g005540.2.1	Solanum lycopersicum	60	75	5e-21

Showing 1 to 10 of 57 entries

Protein sequence

MAKRAKKITLELIQLQSEGTNPNSFSFDHLVQSHEAIPSNSGEVSDSRKFQEDEVMTALKNKGVTMIGIC
GMGGS