PGSC0003DMT400024935 (PRGDB2135255)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2135255	PGSC0003DMT400024935	T	putative	TIR	Solanum tuberosum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
PGSC0003DMT400024932	Solanum tuberosum	99.9	55	1e-34
PGSC0003DMT400024933	Solanum tuberosum	99.9	55	4e-34
PGSC0003DMT400006234	Solanum tuberosum	79.6	54	1e-24
PGSC0003DMT400040557	Solanum tuberosum	79.6	54	6e-24
PGSC0003DMT400040529	Solanum tuberosum	79.6	54	6e-24
PGSC0003DMT400043732	Solanum tuberosum	75	52	2e-21
PGSC0003DMT400043719	Solanum tuberosum	73.1	52	4e-21
PGSC0003DMT400002320	Solanum tuberosum	80	50	4e-21
PGSC0003DMT400080822	Solanum tuberosum	71.2	52	1e-20
PGSC0003DMT400043722	Solanum tuberosum	74	50	5e-20

Showing 1 to 10 of 499 entries

Protein sequence

MSFPSEVRHQTESFAVAFAEHEKKYKDDVEGMQKVKGWRTALSAAADLKGCNVHDR