PGSC0003DMT400083281 (PRGDB2135258)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2135258	PGSC0003DMT400083281	T	putative	TIR	Solanum tuberosum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
PGSC0003DMT400080822	Solanum tuberosum	77.8	72	1e-32
Solyc11g011090.1.1	Solanum lycopersicum	77.5	71	1e-31
PGSC0003DMT400025085	Solanum tuberosum	74.7	71	2e-31
PGSC0003DMT400006227	Solanum tuberosum	76.1	71	4e-31
PGSC0003DMT400062811	Solanum tuberosum	71.2	73	2e-30
PGSC0003DMT400043722	Solanum tuberosum	74.7	71	5e-30
PGSC0003DMT400047499	Solanum tuberosum	70.4	71	2e-29
PGSC0003DMT400043719	Solanum tuberosum	75	72	2e-29
PGSC0003DMT400002320	Solanum tuberosum	72.6	73	3e-29
PGSC0003DMT400047418	Solanum tuberosum	73.6	72	3e-29

Showing 1 to 10 of 499 entries

Protein sequence

MECKEVKGQIVIPIFYDVDPSHVRNQCESLAEAFDKHEWRYKDDVEGMHKVKGWKNALTAAANLVGYDIR
NR