PGSC0003DMT400024924 (PRGDB2135274)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2135274	PGSC0003DMT400024924	T	putative	TIR	Solanum tuberosum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
PGSC0003DMT400080822	Solanum tuberosum	90.8	152	1e-100
PGSC0003DMT400043731	Solanum tuberosum	90.1	152	1e-98
PGSC0003DMT400006227	Solanum tuberosum	87.5	152	2e-95
PGSC0003DMT400031453	Solanum tuberosum	82.2	152	6e-91
PGSC0003DMT400031454	Solanum tuberosum	82.2	152	2e-90
PGSC0003DMT400006229	Solanum tuberosum	87.5	152	3e-87
Solyc11g011350.1.1	Solanum lycopersicum	86.3	153	4e-86
PGSC0003DMT400047418	Solanum tuberosum	85.5	152	2e-85
Bs4	Solanum lycopersicum	85.5	152	3e-85
Solyc05g007850.1.1	Solanum lycopersicum	85.5	152	3e-85

Showing 1 to 10 of 499 entries

Protein sequence

MASSSSFSSASTLQYCPRWKYNVFLSFRGEDTRKTFTGHLYEGLKNRGIFTFQDDKRLEQGDSIPEELLK
AIKESQVALVVFSKNYATSRWFLNELVTIMEFKEEENGQTVILIFYDVDPSHVRYQSESFVEAFAKHESR
YKDDVEGMQKVQGWRTALTAAANLK