PGSC0003DMT400045583 (PRGDB2136435)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2136435	PGSC0003DMT400045583	KIN	putative	Kinase	Solanum tuberosum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
PGSC0003DMT400045580	Solanum tuberosum	99.9	159	7e-114
maker_scaffold32500_augustus_gene_0_14_mRNA_1	Solanum commersonii	97.5	159	4e-110
Solyc04g045600.2.1	Solanum lycopersicum	95.7	161	2e-103
Prupe.1G486900.2.p	Prunus persica	87.4	159	2e-98
Prupe.1G486900.1.p	Prunus persica	87	161	9e-98
Aqcoe7G196300.1.p	Aquilegia caerulea	84.9	159	2e-96
evm_27.model.AmTr_v1.0_scaffold00026.33	Amborella trichopoda	85.5	159	3e-95
Aco006455.1	Ananas comosus	84.9	159	2e-94
Gorai.009G060300.2	Gossypium raimondii	83.8	161	2e-93
Gorai.009G060300.1	Gossypium raimondii	83.8	161	2e-93

Showing 1 to 10 of 499 entries

Protein sequence

MKINYSTSFHFLDLIGPSRGSVLTWHRRIKIALDAARGIEYLHEQCHPPVIHRDLKSSNILLDSNFNAKL
SDFGLAVLGGAQNKNNIKLSGTLGYVAPEYMLDGKLSDKSDVYAFGVVLLELLLGRRPVEKEAPTECQSI
VTWAMPQLTDRSKLPNIVDPVIQNTMDLKHLYQVYHT