Spipo2G0088300 (PRGDB2140835)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2140835	Spipo2G0088300	L	putative	LRR	Spirodela polyrhiza

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.5G201600.2.p	Prunus persica	36.6	251	3e-38
Gorai.006G267600.1	Gossypium raimondii	36	261	8e-38
Gorai.006G267600.2	Gossypium raimondii	36	261	8e-38
Ciclev10021749m	Citrus clementina	36.1	260	2e-37
Manes.06G087000.1.p	Manihot esculenta	35	263	5e-37
AHYPO_008076-RA	Amaranthus hypochondriacus	38.4	232	6e-37
30138.m004005	Ricinus communis	35.1	265	3e-36
evm_27.model.AmTr_v1.0_scaffold00110.43	Amborella trichopoda	33.8	263	1e-35
Glyma.06G201600.1.p	Glycine max	34.2	263	2e-35
Prupe.5G201600.5.p	Prunus persica	34.6	263	3e-35

Showing 1 to 10 of 137 entries

Protein sequence

MGCCASKGRGYAANQATLWRSTGIVALRDRGLRALPNEVLEVDKFIRTLDLTNNKIVGFLVRLEQLSVTG
NMLTSLPETLGNLKNDLSIGRSIAVFHMKRSFLRQSKGNVKRMKIALKWETNYTATEGFQEFEARRKRKF
DKVIDSNVMINSRGLDEGIDF