Thecc1EG044636t1 (PRGDB2141939)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2141939	Thecc1EG044636t1	RLP	putative	TM, LRR	Theobroma cacao

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Thecc1EG030929t1	Theobroma cacao	72.7	154	1e-66
Gorai.009G437000.1	Gossypium raimondii	38.8	160	2e-23
Thecc1EG044542t1	Theobroma cacao	38.9	162	3e-23
Gorai.009G390000.1	Gossypium raimondii	36.6	161	3e-23
Thecc1EG024673t1	Theobroma cacao	39.4	160	4e-23
Gorai.009G373100.1	Gossypium raimondii	51.9	106	1e-22
Gorai.009G436600.1	Gossypium raimondii	37.2	183	2e-22
Thecc1EG031096t1	Theobroma cacao	43.1	130	1e-21
Thecc1EG030915t1	Theobroma cacao	39.8	161	9e-21
Gorai.009G373800.2	Gossypium raimondii	37.1	167	9e-20

Showing 1 to 10 of 128 entries

Protein sequence

MHKLKCVLSLEFKKLFSLHSEELYLSDLGNDKGCDTINFPLKQNLVNLEYVIVGNCVKIFQIQAGHFFSR
VELIQLKHLYQLQGPIEVASLQCLKGLCVSECSRLKFLLSPMLARNLPQLINLVVEYCKELEEIIDMDQT
SASSSQGYLQPISFPNLKYIQIQEYSNLKSLFPLVSPILFQNSKTSQFMGLLNLS