Thecc1EG025531t1 (PRGDB2141941)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2141941	Thecc1EG025531t1	RLP	putative	TM, LRR	Theobroma cacao

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Thecc1EG025544t1	Theobroma cacao	80.2	96	9e-47
Thecc1EG025533t1	Theobroma cacao	78.8	99	1e-45
Thecc1EG025536t1	Theobroma cacao	76.5	98	2e-44
Thecc1EG025538t1	Theobroma cacao	76.5	98	1e-43
Thecc1EG025535t1	Theobroma cacao	66.7	96	1e-35
Thecc1EG025532t1	Theobroma cacao	64.6	96	5e-35
Thecc1EG025523t1	Theobroma cacao	60.8	102	2e-33
Thecc1EG025526t1	Theobroma cacao	62	100	1e-32
Thecc1EG025527t1	Theobroma cacao	65.3	95	1e-31
Thecc1EG025539t1	Theobroma cacao	56.1	107	3e-27

Showing 1 to 10 of 499 entries

Protein sequence

MVIIGGLPKLEVLPQWLLGGSANTLQLLALVECENLTTFPDRQNLTSLERLVIRDCPNLSSLPERMQCLK
ELNIGRCPILSEGYKPENGEDWAKISHGTSAFNGVGLAVVFM