Thecc1EG031857t1 (PRGDB2141968)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2141968	Thecc1EG031857t1	RLP	putative	LRR, TM	Theobroma cacao

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Thecc1EG046015t1	Theobroma cacao	87.6	121	1e-66
Thecc1EG031839t1	Theobroma cacao	83.7	123	1e-65
Thecc1EG031844t1	Theobroma cacao	85.2	122	8e-65
Thecc1EG046011t1	Theobroma cacao	82.9	123	2e-62
Thecc1EG031847t1	Theobroma cacao	82.9	123	2e-61
Thecc1EG046017t1	Theobroma cacao	81.3	123	4e-61
Thecc1EG031790t1	Theobroma cacao	82.1	123	7e-61
Thecc1EG031848t1	Theobroma cacao	80.5	123	4e-59
Thecc1EG046014t1	Theobroma cacao	82.3	113	7e-58
Thecc1EG046013t1	Theobroma cacao	87	108	5e-54

Showing 1 to 10 of 499 entries

Protein sequence

MLMISLSRAFKTPSDGFDVLGVGGYLKILIFRILSQLTNLTFLEVLNLSLVGPIPPGKQFDTFENDSYSG
NLGLCDLQLSKQCGNPEPKPPVALLKEDEGSEIAFIWKVVMMGYGCGVVLGFNMGYIVFTTGRPWWFIKM
VERDWQKNVTN