Thecc1EG031396t1 (PRGDB2142066)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2142066	Thecc1EG031396t1	L	putative	LRR	Theobroma cacao

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Thecc1EG031406t1	Theobroma cacao	82	217	3e-111
Gorai.013G167800.4	Gossypium raimondii	74.7	217	7e-101
Gorai.013G167800.3	Gossypium raimondii	74.7	217	9e-101
Gorai.013G167800.1	Gossypium raimondii	74.7	217	1e-100
Gorai.013G167800.2	Gossypium raimondii	74.7	217	1e-100
Prupe.4G184800.6.p	Prunus persica	68.5	216	4e-94
Thecc1EG031406t4	Theobroma cacao	80.2	192	7e-94
Prupe.4G184800.5.p	Prunus persica	68.5	216	1e-93
orange1.1g014560m	Citrus sinensis	69.9	216	2e-93
Prupe.4G184800.4.p	Prunus persica	68.5	216	5e-93

Showing 1 to 10 of 499 entries

Protein sequence

MGLSVVPSEVWESGEITKVNLSRNSIQELPIEISSCLSLQLDNNPLRQIPSDGFQAISMLHILDLSGNAA
SLPENPAFSSLPHLKELYLKRMQLREVPSEIMSLCQLQILDFGQNSLQSIPGGLNSLTSLTELDLSDNSI
SALPPELGLLEPSLQVLRLDGNPLRSIRRAILDKGTKAVLKYLKDKILEQ