Traes_4BL_9810197AC.2 (PRGDB2144328)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2144328	Traes_4BL_9810197AC.2	N	putative	NBS	Triticum aestivum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MLOC_70111.1	Hordeum vulgare	84.8	66	4e-32
Traes_4DL_52DE58ED5.2	Triticum aestivum	81.8	66	6e-32
Traes_4DL_52DE58ED5.1	Triticum aestivum	81.8	66	6e-32
Traes_4DL_52DE58ED5.3	Triticum aestivum	81.8	66	6e-32
EMT19376	Aegilops tauschii	81.8	66	9e-32
TRIUR3_18994-P1	Triticum urartu	80.3	66	1e-30
Traes_4AS_35FB8DB6E.1	Triticum aestivum	80.3	66	6e-30
Bradi1g67840.1.p	Brachypodium distachyon	68.2	66	2e-23
OPUNC03G10530.1	Oryza punctata	71.9	64	2e-23
Pavir.Ib01063.1.p	Panicum virgatum	68.2	66	5e-23

Showing 1 to 10 of 351 entries

Protein sequence

LCSTAQQVAAECNGMPLFLATVGRAMSNKRTAEEWSDALDKLKKPQLTSSAPGHDKSAHPLVKFCF