Traes_1DL_99673F3C8.1 (PRGDB2144332)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2144332	Traes_1DL_99673F3C8.1	N	putative	NBS, TM	Triticum aestivum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Traes_1DL_99673F3C8.2	Triticum aestivum	99.9	91	8e-60
Brast08G048700.1.p	Brachypodium stacei	75.6	90	5e-42
Traes_1DL_80079911E.1	Triticum aestivum	74.7	91	4e-41
Bradi2g18840.1.p	Brachypodium distachyon	67	91	4e-37
Bradi2g18851.1.p	Brachypodium distachyon	69.6	92	9e-37
Traes_1DL_BAB368FF2.1	Triticum aestivum	74.7	83	1e-36
EMT30566	Aegilops tauschii	71.4	91	3e-35
Bradi2g18830.2.p	Brachypodium distachyon	70.8	89	4e-35
OPUNC01G29040.1	Oryza punctata	60.2	88	1e-32
LPERR05G19610.1	Leersia perrieri	57.1	91	5e-32

Showing 1 to 10 of 499 entries

Protein sequence

MTSGSKIIVTSRSEKMVRFGTTEAIKLSCLSKEAYWYFFKMLVFGSTDPEEHPRLTSIAMELALRMCGSF
ISAYVIAALLSENHSAWFWCR