Traes_6DL_6551C3F52.2 (PRGDB2144682)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2144682	Traes_6DL_6551C3F52.2	RLP	putative	LRR, TM	Triticum aestivum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Traes_6DL_6551C3F52.4	Triticum aestivum	99.9	157	1e-112
Traes_6DL_6551C3F52.3	Triticum aestivum	96	150	3e-94
EMT01030	Aegilops tauschii	98.3	121	3e-77
Traes_6DL_6551C3F52.1	Triticum aestivum	98.3	121	3e-77
Traes_6AL_2A7DFCD46.2	Triticum aestivum	91.2	137	2e-74
Traes_6AL_C44818558.1	Triticum aestivum	80.3	137	3e-67
TRIUR3_30656-P1	Triticum urartu	90.9	121	8e-63
Traes_6AL_2A7DFCD46.1	Triticum aestivum	90.9	121	1e-61
EMT01029	Aegilops tauschii	80.5	113	1e-51
MLOC_21196.3	Hordeum vulgare	82.4	108	5e-51

Showing 1 to 10 of 499 entries

Protein sequence

MQERLPFRVIRPSKGDMAISQAARLATMLMLLPLLLISCGVGSILCSSMTTVHDNSTDMISLLDFKRAIT
NDSRQALTSWHTSFPLCSWEGVHCSSGRVTKLYLRQRGLFGRISSSLGNLTFLRTLDLSKNGFTGNMDFF
LEEHWICPHVRPSLGEKKHSMFYLIIVLRHYNT