Traes_2AS_1C4822084.1 (PRGDB2145588)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2145588	Traes_2AS_1C4822084.1	RLP	putative	TM, LRR	Triticum aestivum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
EMT32658	Aegilops tauschii	98.5	202	1e-142
Traes_2DS_EE4E7DC1E.8	Triticum aestivum	98.5	202	2e-139
Traes_2DS_EE4E7DC1E.2	Triticum aestivum	98.5	202	4e-139
Traes_2DS_EE4E7DC1E.1	Triticum aestivum	98.5	202	4e-139
Traes_2DS_EE4E7DC1E.6	Triticum aestivum	98.5	202	4e-139
Traes_2DS_EE4E7DC1E.3	Triticum aestivum	98.5	202	4e-139
Traes_2DS_EE4E7DC1E.5	Triticum aestivum	98.5	202	4e-139
Traes_2DS_EE4E7DC1E.4	Triticum aestivum	98.5	202	4e-139
Traes_2DS_EE4E7DC1E.7	Triticum aestivum	98.5	202	4e-139
Bradi1g26830.1.p	Brachypodium distachyon	91.6	202	1e-127

Showing 1 to 10 of 499 entries

Protein sequence

TCRGLDNQGLRGVIPSDVSKLQHLQSINFSGNSIKGNIPLSLGTIPGLRVLDLSFNELNGSIPESLGQLT
SLQTLNLNGNDLSGRVPASLGGRPLHRVRFNFTDNAGLCGIPGLHECGPHLSVAAKIGMAFGVLVAFLFL
VVFAACWWKRRQNVIRGQKLAAAREAPYAKSRTQFTRDVQMGKHHRPHETSPRGGNNESSPHLLA