Traes_3B_8E01C0351.5 (PRGDB2146854)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2146854	Traes_3B_8E01C0351.5	KIN	putative	Kinase	Triticum aestivum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Traes_3B_8E01C0351.4	Triticum aestivum	99.9	193	6e-140
Traes_3B_8E01C0351.2	Triticum aestivum	99.9	193	2e-139
Traes_3B_8E01C0351.3	Triticum aestivum	99.9	193	2e-137
Traes_3B_8E01C0351.1	Triticum aestivum	99.9	193	4e-137
MLOC_56554.8	Hordeum vulgare	89.4	198	1e-128
MLOC_56554.1	Hordeum vulgare	89.4	198	4e-125
Brast01G397700.3.p	Brachypodium stacei	78	209	4e-107
Brast01G397700.2.p	Brachypodium stacei	78	209	4e-107
Brast01G397700.1.p	Brachypodium stacei	78	209	4e-107
Seita.5G086900.1.p	Setaria italica	76.2	206	1e-106

Showing 1 to 10 of 499 entries

Protein sequence

MARLFLEDATHVNTFRISGTYGYMAPEYAMSGYLSTKTDVFSFGMLVLEIVSGRKNIDRHLGDEKIDLLN
YTWKLSEEGRSLEIVDPGLSGWDAGEVAMCVQLGLLCCQAVVSDRPDMYSVHLMLSSDSFTLPKPGKPAV
HGRVGRWKSATGSXGANTNTTFATDTTRASTLGNIAEDESRNSISISFTTEGR