Traes_4DS_9268B46A7.5 (PRGDB2147319)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2147319	Traes_4DS_9268B46A7.5	KIN	putative	Kinase	Triticum aestivum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Traes_4DS_9268B46A7.1	Triticum aestivum	99.9	202	3e-148
TRIUR3_32791-P1	Triticum urartu	99	202	9e-148
MLOC_37279.3	Hordeum vulgare	96	202	3e-144
Traes_4BS_6F5D015E1.1	Triticum aestivum	97	202	5e-144
MLOC_37279.2	Hordeum vulgare	96	202	8e-144
MLOC_37279.5	Hordeum vulgare	96	202	9e-144
MLOC_37279.4	Hordeum vulgare	96	202	9e-144
Traes_1BL_3D42EA937.2	Triticum aestivum	84.3	204	5e-127
Traes_1AL_A78FD4ED4.2	Triticum aestivum	83.8	204	5e-126
Traes_1AL_A78FD4ED4.1	Triticum aestivum	83.8	204	5e-126

Showing 1 to 10 of 499 entries

Protein sequence

VLEYVEGKIVWDKGIGEATCRKYLRDIISGVIYLHSHNIIHSDIKPDNLLVTSTGNVKIGDFSVSQIFED
DDDMLRRSPGTPVFTAPECCQGSAYHGRASDTWAVGVTLYCMITGRYPFLGETLQETYDKIVNDPADIPS
NVSPQLVDLLERLLCKDPGDRITLEAAAAHPWVAGDEGPVPEYMCRCGFGRRKRNGSQEAVQ