Traes_4BS_1394B6A52.1 (PRGDB2148364)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2148364	Traes_4BS_1394B6A52.1	KIN	putative	TM, Kinase	Triticum aestivum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MLOC_62720.1	Hordeum vulgare	85.7	203	1e-115
EMT19703	Aegilops tauschii	82.2	191	1e-103
EMT29215	Aegilops tauschii	80	195	2e-100
Traes_4AS_F9719EBBA.1	Triticum aestivum	73	200	2e-99
EMT23294	Aegilops tauschii	78	182	3e-96
TRIUR3_12481-P1	Triticum urartu	70.4	203	1e-95
TRIUR3_01459-P1	Triticum urartu	71	200	2e-93
EMT12161	Aegilops tauschii	70.4	189	7e-91
EMT10139	Aegilops tauschii	70.2	191	4e-89
EMT19702	Aegilops tauschii	78.9	166	1e-86

Showing 1 to 10 of 499 entries

Protein sequence

MWKLLTGARTMHDRHVVHRDIKPGNILVGQDGELVKICDFGLAISMSELPPYNQAGTPFYVAPEVLLGKR
DYNALVDTWSIGCVMAEMLTGKTLFLGDDDDDAKDNEIIQLWSIFRLLGTPDERTWPGFTSLPLTEKTLK
LLPRGHKHNKLRDLFPEEKLSEHGFQVLQGLLTCNPDKRLTAAAALKHRWFAAPRPSAA