Traes_7AS_899D93ED7.4 (PRGDB2152312)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2152312	Traes_7AS_899D93ED7.4	KIN	putative	Kinase	Triticum aestivum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
TRIUR3_13632-P1	Triticum urartu	99.5	203	1e-146
Traes_7BS_AF44F1D7D.1	Triticum aestivum	99.5	203	4e-146
EMT17432	Aegilops tauschii	99.5	203	8e-146
MLOC_38027.3	Hordeum vulgare	98.5	203	4e-145
MLOC_38027.1	Hordeum vulgare	98.5	203	4e-145
Traes_7DS_927865EC2.1	Triticum aestivum	99	203	6e-145
Traes_7DS_927865EC2.2	Triticum aestivum	99	203	1e-144
Bradi3g41740.2.p	Brachypodium distachyon	95.1	203	9e-138
Pavir.J18826.1.p	Panicum virgatum	93	200	3e-137
Brast03G294400.1.p	Brachypodium stacei	94.6	203	7e-137

Showing 1 to 10 of 499 entries

Protein sequence

GKAPPSIEVPELSFDELKEKTDDFGSKALVGEGSYGRVYYAVLENGTHVAVKKLDTSADPEPDNEFIAQV
SVISRLKHEHFVDMLGYCLEGDQRLLAYEFATMGSLHDILHGRKGVAGAQPGPALDWMQRINIAVDAAKG
LEHLHEKVQPSVVHRDIRSSNVLLFEDYKAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPECMP