EMT32125 (PRGDB2154)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2154	EMT32125	RLP	putative	LRR, TM	Aegilops tauschii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Traes_2DL_3557098A3.1	Triticum aestivum	99.9	170	8e-117
Traes_2DL_3557098A3.2	Triticum aestivum	99.9	170	8e-114
Traes_2AL_29B2C075A.1	Triticum aestivum	90.6	170	3e-103
Traes_2AL_29B2C075A.3	Triticum aestivum	90.6	170	2e-102
Traes_2AL_29B2C075A.2	Triticum aestivum	90.6	170	1e-100
EMT32126	Aegilops tauschii	89.4	170	4e-99
TRIUR3_22164-P1	Triticum urartu	83.5	170	3e-95
TRIUR3_12522-P1	Triticum urartu	77.1	170	1e-89
MLOC_57698.1	Hordeum vulgare	80.6	170	5e-88
EMT33454	Aegilops tauschii	81.2	170	2e-87

Showing 1 to 10 of 499 entries

Protein sequence

MAGIDLSANMLDGEIPWELGNLRHIKSLNLSSNFFVGPIPTTLGGMGEIESLDLSHNELSGPIPWQLTQL
SSLGVFSVAYNNLSGCIPNSGQLSSFNMDSYLANINLHNITHGNTCAAPSPDPAAGKDVEEMRSDPVLYV
VTAVGFVFAFWATIGFSFCHPYGRSVMLKL