TRIUR3_17484-P1 (PRGDB2161919)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2161919	TRIUR3_17484-P1	T	putative	TM, TIR	Triticum urartu

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Traes_2AS_5A3373A3D.1	Triticum aestivum	99.3	136	8e-94
Traes_2BS_E50A72202.1	Triticum aestivum	96.3	136	4e-91
EMT26193	Aegilops tauschii	99.2	123	1e-82
Brast06G088800.1.p	Brachypodium stacei	79.6	137	2e-71
Bradi1g24377.1.p	Brachypodium distachyon	78.1	137	2e-70
Brast06G088700.1.p	Brachypodium stacei	72.1	136	3e-65
LPERR07G16330.1	Leersia perrieri	70.6	136	9e-62
OPUNC07G17910.1	Oryza punctata	69.8	136	2e-61
LOC_Os07g37950.1	Oryza sativa	69.1	136	8e-61
ORUFI07G19790.1	Oryza rufipogon	69.1	136	8e-61

Showing 1 to 10 of 499 entries

Protein sequence

MSMRPGDRLRETISARISECSVAVAIFSPSYFDSEYCLWELATLVESRKTIIPIFYNIKPSDLVLPEALA
ASDDYLPQDVERYKYALREAKNTVGLTYDSATGDIAELVSAAADAVLYHMEKMERVQRRETIVSRL