TRIUR3_23425-P1 (PRGDB2161948)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2161948	TRIUR3_23425-P1	L	putative	LRR	Triticum urartu

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
TRIUR3_29957-P1	Triticum urartu	99.9	81	7e-52
Traes_3B_71B0435DF.2	Triticum aestivum	97.5	81	1e-46
Traes_3B_71B0435DF.1	Triticum aestivum	97.5	81	1e-46
Traes_3B_71B0435DF.4	Triticum aestivum	97.5	81	2e-46
Traes_3B_71B0435DF.3	Triticum aestivum	97.5	81	2e-46
MLOC_66147.3	Hordeum vulgare	88.8	80	8e-41
MLOC_66147.1	Hordeum vulgare	88.8	80	8e-41
Brast10G111400.1.p	Brachypodium stacei	85.2	81	6e-40
Sobic.007G128600.1.p	Sorghum bicolor	77.8	81	3e-35
Sobic.007G128600.2.p	Sorghum bicolor	77.8	81	3e-35

Showing 1 to 10 of 499 entries

Protein sequence

FTEEQDKVICHLTSLHILDFCYCSDLISLPKELHRLSSVKKLSIKACPGILSLPEMGLPASLQELYVSNC
STELKEQCRKI