TRIUR3_00389-P1 (PRGDB2161953)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2161953	TRIUR3_00389-P1	RLP	putative	LRR, TM	Triticum urartu

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
EMT24090	Aegilops tauschii	55.2	174	7e-53
Traes_6DS_458F306C01.2	Triticum aestivum	58.8	165	7e-49
Traes_6DS_458F306C01.1	Triticum aestivum	58.8	165	7e-49
EMT32765	Aegilops tauschii	58.8	165	7e-49
EMT00427	Aegilops tauschii	54.4	180	1e-48
MLOC_37770.1	Hordeum vulgare	56.6	173	3e-46
MLOC_45035.1	Hordeum vulgare	56.8	169	1e-45
Brast10G128400.1.p	Brachypodium stacei	55.6	153	8e-43
EMT32767	Aegilops tauschii	54.2	190	1e-42
EMT24091	Aegilops tauschii	55	149	2e-42

Showing 1 to 10 of 499 entries

Protein sequence

MHRSPSVFVLLLMAATWSSLFPANDARHLEPAHAAGGRCIGRERDALLVFKQGIDDDVDDYLESWQLGRQ
DCCRWKGVTCDEVTGHVIQLDLSHKTLVGQMRNSLLSLQHLGHLALSWVSLCMHNSRLEFLGSFNNLRHL
DLSYISCGSVLPQIGNLSKLEYFEITSTYFFRQRDNWDSARWLTSYETSHG