GRMZM2G149994_P03 (PRGDB2166793)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2166793	GRMZM2G149994_P03	N	putative	NBS, TM	Zea mays

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Aco017571.1	Ananas comosus	77.8	99	8e-42
evm.model.supercontig_1.136	Carica papaya	76.7	103	1e-41
EFJ25968	Selaginella moellendorffii	63.2	106	3e-39
EFJ05546	Selaginella moellendorffii	67.7	93	5e-39
Zosma201g00110.1	Zostera marina	71	107	5e-39
Carubv10016877m	Capsella rubella	74.5	98	1e-38
Bo9g074370.1	Brassica oleracea	73.5	98	2e-38
36182	Ostreococcus lucimarinus	48	98	3e-25
Migut.J01627.2.p	Erythranthe guttata	46.1	102	8e-25
Migut.J01627.1.p	Erythranthe guttata	46.1	102	1e-24

Showing 1 to 10 of 496 entries

Protein sequence

MLNLCEGDKVLKLLMEDWECARSMVGPSITRGVTKEISIVSWDDIGGLKDLKKELQKVVEWPIKHAAAFS
RLGIPPVRGVLLHGPPGCSKTTLAKAAAHAAQASFFSLRFIRKQHFILRK