GRMZM2G459224_P01 (PRGDB2168662)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2168662	GRMZM2G459224_P01	KIN	putative	Kinase	Zea mays

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
GRMZM2G174585_P02	Zea mays	99.9	108	2e-69
GRMZM2G089461_P03	Zea mays	99.1	108	4e-69
GRMZM2G174585_P01	Zea mays	99.9	108	5e-69
GRMZM2G089461_P02	Zea mays	99.1	108	6e-69
GRMZM2G089461_P01	Zea mays	99.1	108	1e-68
Pavir.J04156.2.p	Panicum virgatum	96.3	108	4e-67
Sevir.3G207400.6.p	Setaria viridis	95.4	108	4e-67
Sevir.3G207400.2.p	Setaria viridis	95.4	108	5e-67
Pavir.J00952.1.p	Panicum virgatum	96.3	108	5e-67
Sobic.009G175600.2.p	Sorghum bicolor	96.3	108	7e-67

Showing 1 to 10 of 499 entries

Protein sequence

MAIATNNFDLSAQVGQGGYGKVYKGILGDGALVAIKRAHQDSLQGSREFCTEIELLSRLHHRNLVSLVGY
CDEEDEQMLVYEFMSNGTLRDHLSAKSKRPLSFGLRLKSHWVLQREFCIYILKQITISTWM