Zosma6g01760.1 (PRGDB2169483)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2169483	Zosma6g01760.1	L	putative	LRR	Zostera marina

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Zosma87g00840.1	Zostera marina	76.7	176	8e-79
Zosma87g01050.1	Zostera marina	66	200	3e-74
Zosma87g00900.1	Zostera marina	73.7	156	3e-68
Zosma87g00870.1	Zostera marina	62.3	175	7e-64
Zosma87g00830.1	Zostera marina	53.2	216	4e-57
Zosma58g01070.1	Zostera marina	57.5	113	2e-30
Zosma87g00490.1	Zostera marina	53.5	116	4e-28
Zosma87g00470.1	Zostera marina	51.4	111	5e-26
Pp3s203_40V3.1.p	Physcomitrella patens	42.5	113	5e-20
Pp3s203_40V3.2.p	Physcomitrella patens	42.5	113	7e-20

Showing 1 to 10 of 499 entries

Protein sequence

MSCLQSLTHLEIYYCPNLTTLPNDMCSFQFLTHLEIYYCINLTSLPNDMYFLESLIHLVIVYCQNLTSLP
NNMCRLKSLTALIIKSCPNLVDVSFSLEHFPSLKEIEVNDCDQWIRNWSNDAISRICSIEKRSWISICSE
DDDIDLLSRWLRKKIDSTKILDRLQIMSGGHGNRFF